rewire.it

A Bioinformatician's Guide to Choosing Genomic Foundation Models

A practical guide to selecting genomic foundation models for bioinformatics tasks. Covers ESM-2, DNABERT-2, HyenaDNA, Nucleotide Transformer, scGPT, and Evo with specific recommendations for DNA sequence analysis, protein structure prediction, and single-cell analysis based on hardware requirements, inference speed, and task type.

When Meta AI released their ESM Metagenomic Atlas, they predicted the 3D structures of "more than 617 million" proteins1 in two weeks using approximately 2,000 GPUs2. That's more structures than had been experimentally determined in the entire history of structural biology, produced in the time it takes most labs to crystallize a single protein.

You have a variant effect prediction task. Or maybe you need to annotate cell types from single-cell RNA-seq. Perhaps you want to predict how a mutation affects protein structure. The models exist. They have impressive benchmarks. But which one should you actually use?

This is the question I kept running into while evaluating genomic foundation models for production pipelines. The papers report state-of-the-art results, but rarely tell you about GPU memory requirements, inference speed, or what happens when your sequences are longer than the training context. This guide covers model selection, fine-tuning strategies, and hardware requirements.

The Decision Tree: What Are You Actually Trying to Do?

Before examining architectures, we first need to establish which model family matches your task. Foundation models in genomics fall into distinct categories with different strengths.

The Nucleotide Transformer family includes models trained on different data sources, enabling predictions across chromatin accessibility, transcription factor binding, and variant effects. Figure 1: Nucleotide Transformer overview showing model variants and downstream prediction tasks. Source: Dalla-Torre et al., "The Nucleotide Transformer", 20243

DNA Sequence Tasks

If you're working with regulatory element prediction, variant effect scoring, or promoter identification, you need a DNA foundation model. The current options include several with dramatically different resource requirements.

DNABERT-2 stands out for human genome tasks. It "achieves comparable performance to the state-of-the-art model with 21x fewer parameters and approximately 92x less GPU time in pre-training"4. With only 117M parameters5, it runs comfortably on consumer GPUs. The key innovation is replacing k-mer tokenization with Byte Pair Encoding (BPE), which "significantly reduces the sequence length by approximately 5 times"6.

HyenaDNA becomes essential when you need long-range context. The model handles "context lengths of up to 1 million tokens at the single nucleotide-level"7, representing "an up to 500x increase over previous dense attention-based models"8. At sequence length 1M, "HyenaDNA is 160x faster than its Transformer counterpart"9. This speed comes from a fundamental algorithmic advantage: "a Hyena operator can be evaluated in O(L log L) time"10 rather than the O(L^2) of standard attention.

A caveat on HyenaDNA: The computational efficiency gains are real and significant, but benchmark performance on downstream tasks is more mixed. In practice, HyenaDNA doesn't consistently outperform attention-based models on accuracy metrics in independent evaluations. The architecture shines when you genuinely need long-range context that transformers can't handle, but for sequences under 32k tokens, you may find DNABERT-2 or Nucleotide Transformer deliver better results despite their computational overhead. If zero-shot or fine-tuning with existing foundation models isn't getting the performance you need for 10k-100k sequences, consider pre-training ModernBERT on your domain-specific data. With sufficient BPE compression, it can handle long sequences on a single GPU and may outperform fine-tuning general models.

Nucleotide Transformer offers the largest parameter counts (up to 2.5 billion) and benefits from diverse training data "integrating information from 3202 diverse human genomes as well as 850 genomes from a wide range of species"11. If you need cross-species generalization, this is your starting point.

Protein Tasks

For protein structure, function prediction, or variant pathogenicity:

ESM-2 remains the workhorse. The model family scales "from 8 million parameters up to 15 billion parameters"12, with the 15B version being "the largest language model of proteins to date"13. But here's the practical insight: you probably don't need the 15B model. The benchmark improvements follow a log-linear scaling pattern, and the 650M model captures most of the benefit while fitting on a single GPU.

ESMFold delivers structure prediction "up to 60x faster than state-of-the-art while maintaining resolution and accuracy"14. On a V100 GPU, "ESMFold makes a prediction on a protein with 384 residues in 14.2 seconds, 6x faster than a single AlphaFold2 model"15. For shorter sequences, "the improvement increases up to approximately 60x"16.

ESM-2 demonstrates that protein structure emerges from language model scale. Contact prediction improves systematically, and structure prediction quality increases with model size. Figure 2: ESM-2 scaling analysis showing how contact prediction accuracy and structure quality improve with model size. Source: Lin et al., "ESM-2: Evolutionary Scale Modeling", 202217

Single-Cell Analysis

For cell type annotation, batch integration, or perturbation prediction:

scGPT offers the most comprehensive feature set. It's trained on "33 million scRNA-seq data of human cells"18 from "51 organs/tissues and 441 studies"19. What makes it practical is the scaling law finding: "larger pre-training data sizes yield superior pre-trained embeddings"20, which means the large pretrained model will likely outperform smaller models trained from scratch on your specific dataset.

Geneformer works well when you have limited labeled data. The model benefits from transfer learning, showing "8 to 12% increase in the biological conservation score compared to the trained-from-scratch models"21.

The Efficiency Revolution: Why This Matters for Your Lab

Training a genomic foundation model used to require 128 NVIDIA A100 GPUs running for 28 days. DNABERT-2 achieves comparable performance with 8 RTX 2080Ti cards in 14 days22, which brings pre-training within reach of a departmental GPU budget.

Model Training Hardware Training Time Estimated Cost
Nucleotide Transformer (2.5B) 128 A100 GPUs 28 days ~$1,000,000
DNABERT-2 8 RTX 2080Ti 14 days ~$2,000
HyenaDNA 8 A100 GPUs ~7 days ~$25,000

Table 1: Training compute requirements for genomic foundation models. Hardware and duration are from Zhou et al., 202422 and Dalla-Torre et al., 20243. The dollar figures are my own order-of-magnitude estimates from on-demand cloud GPU rates, not costs reported in either paper; treat them as indicative of the ratio rather than the absolute spend.

Benchmarks That Actually Matter: GenBench Results

The GenBench framework "encompasses ten popular GFMs and performs extensive experiments across forty-three realistic datasets"23, providing the most comprehensive model comparison available. Here's what their analysis reveals for practical model selection.

Nucleotide Transformer benchmark results across 18 genomic prediction tasks including enhancers, promoters, splice sites, and histone modifications. Figure 3: Benchmark performance across diverse genomic prediction tasks. Source: Dalla-Torre et al., "The Nucleotide Transformer", 20243

Pooling Strategy

This finding is from Feng et al.'s benchmark of DNA foundation models, with Peng Wei and Chong Wu as senior authors, rather than from GenBench: "Mean token embedding consistently and significantly improves sequence classification performance, outperforming other pooling strategies"24. If you are using CLS token pooling or max pooling, mean pooling across all tokens is the better default.

Note: Pooling strategies are an active research area. That result was published in 2025 and newer approaches continue to emerge. Mean pooling is a reasonable default, but it is worth checking recent literature for your specific task.

Attention vs. Convolution Trade-offs

GenBench evaluated "four attention-based models and six convolution-based models"25. The computational complexity difference is dramatic: "HyenaDNA and Caduceus utilize the hyena operator and state space model with complexity of O(L log L) and O(L) significantly lower than O(L^2) of attention-based models"26.

For sequences under 4kb, attention-based models like DNABERT-2 work fine. Beyond that, the quadratic scaling becomes prohibitive and you need convolution-based alternatives.

Computational Scaling of Sequence Modeling Architectures. Standard transformer attention scales quadratically, becoming infeasible beyond 64k tokens, while Hyena and Mamba enable processing of full genomic sequences. Figure 4: Computational complexity comparison showing attention O(L^2) vs Hyena O(L log L) vs Mamba O(L) scaling across sequence lengths. Generated based on theoretical complexity analysis described in [Nguyen et al., 2023]27 and [GenBench, 2024]26.

Task-Specific Performance Patterns

Different models excel on different task categories. DNABERT-2 shows the most consistent performance on human genome-related tasks. However, for coding regions, remember that "the Coding Region comprising only about 1.5% of the genome is responsible for coding proteins"28 while "the vast Non-coding Region making up 98.5% of the genome plays crucial roles in gene regulation"29. Models trained primarily on coding sequences may underperform on regulatory region tasks.

Hardware Requirements: What You Actually Need

Compute requirements drive most practical decisions, so here are the specifics.

Memory Requirements by Model

ESM-2 variants:

  • 8M parameters: 1GB VRAM (runs anywhere)
  • 150M parameters: 2GB VRAM
  • 650M parameters: 8GB VRAM (most V100s/A100s)
  • 3B parameters: 24GB VRAM (A100-40GB)
  • 15B parameters: 80GB+ VRAM (multi-GPU required)

DNA models:

  • DNABERT-2 (117M parameters): 4GB VRAM
  • NT-2500M (2.5B parameters): 24GB VRAM
  • HyenaDNA (1.6M parameters): 4GB VRAM, but memory scales with context length

For reference on training scale, ProtTrans models required "training on the Summit supercomputer using 5616 GPUs and TPU Pod up to 1024 cores"30. You won't be pretraining from scratch. Fine-tuning is the practical path.

Training Time Expectations

DNABERT-2 pretraining took "about 14 days on 8 NVIDIA RTX 2080Ti V.S. 28 days on 128 NVIDIA A100"22 for comparable Nucleotide Transformer results. But you're fine-tuning, not pretraining. Nucleotide Transformer supports "parameter-efficient fine-tuning technique requiring only 0.1% of the total model parameters"31, which makes single-GPU fine-tuning viable for most tasks. Note that Dalla-Torre et al. used (IA)3, which rescales inner activations with learned vectors, not LoRA. Both are parameter-efficient fine-tuning methods, but they are different techniques and the distinction matters if you are reproducing their setup.

For single-GPU fine-tuning with batch size 8:

  • DNABERT-2: ~2 hours for 10k samples
  • ESM-2 650M: ~4 hours for 10k samples
  • HyenaDNA at 32k context: ~8 hours for 10k samples

Inference Speed Benchmarks

This is where model choice really matters for production:

ESMFold structure prediction on V100:

  • 384 residues: 14.2 seconds
  • Short sequences (<100 residues): ~0.2 seconds (60x faster than AlphaFold2)

A reality check on "metagenome-scale": That 14.2 seconds per protein sounds fast until you do the math. On a single V100, you can process roughly 6,000 proteins per day. A typical bacterial genome has 3,000-5,000 proteins, so you're looking at 1-2 genomes per day. If you have hundreds or thousands of metagenome-assembled genomes to process, you're looking at months of compute time on modest hardware. The "two-week computation" that Meta achieved for 617 million proteins required approximately 2,000 GPUs. For small labs without access to that scale of compute, there's still significant value in lighter-weight methods for metagenome-scale analyses, or strategic sampling rather than exhaustive structure prediction.

For long-context DNA tasks, "HyenaDNA effectively solves the task by using a context length of 450k to 1 million"32 achieving "99.5% accuracy"33 on species classification where transformers are simply infeasible due to quadratic memory requirements.

HyenaDNA achieves strong performance with minimal fine-tuning across regulatory element prediction tasks. Figure 5: HyenaDNA accuracy scaling across genomic tasks. Source: Nguyen et al., "HyenaDNA: Long-Range Genomic Modeling", 202327

When to Fine-tune vs. Use Zero-shot

The decision between fine-tuning and zero-shot embedding extraction depends on your data availability and task specificity.

Zero-shot Works When:

Nucleotide Transformer demonstrates that "the sequence representations alone match or outperform specialized methods on 12 of 18 prediction tasks"34. Zero-shot embedding extraction works well for:

  • Standard regulatory element classification
  • Cross-species generalization tasks
  • When you have fewer than 1000 labeled examples

Fine-tuning Required When:

"Fine-tuned models matched or surpassed 15 of the 18 baselines with the largest and more diverse models constantly outperforming their smaller counterparts"35. Fine-tune when you need:

  • Maximum accuracy on a specific task
  • Custom sequence types (non-standard organisms, synthetic sequences)
  • Cell type annotation in novel tissue contexts

Parameter-Efficient Fine-tuning

You don't need to update all parameters. Parameter-efficient fine-tuning "requiring only 0.1% of the total model parameters"31 achieves comparable results while fitting larger models on smaller GPUs. This is the practical default for most production use cases. The 0.1% figure is from the Nucleotide Transformer authors using (IA)3; LoRA is the more common choice elsewhere and is what DNABERT-2 supports, so budget parameter counts against the method you actually pick.

scGPT embeddings effectively integrate cells across batches while preserving biological cell type structure. Figure 6: scGPT cell embeddings demonstrating batch integration capability. Source: Cui et al., "scGPT: Single-Cell Multi-Omics", 202436

Practical Decision Matrix

Here's my recommendation for common scenarios:

Variant effect prediction on human variants:

  • Start with DNABERT-2 (fastest iteration)
  • If accuracy insufficient, try Nucleotide Transformer 2.5B
  • For protein-coding variants specifically, use ESM-2 650M

Regulatory element prediction:

  • Sequences < 6kb: DNABERT-2 or Nucleotide Transformer
  • Sequences 6kb-100kb: HyenaDNA at 32k context, or consider pre-training ModernBERT with BPE compression if zero-shot/fine-tuning isn't sufficient
  • Sequences > 100kb: HyenaDNA at 1M context or Evo

Single-cell analysis:

  • Cell type annotation: scGPT (highest accuracy)
  • Batch integration: scGPT achieves "an AvgBIO score of 0.821, which is 5-10% higher than the compared methods"37
  • Limited training data: Geneformer transfer learning

Protein structure prediction:

  • Speed priority: ESMFold
  • Accuracy priority on single proteins: AlphaFold2
  • Protein-ligand complexes: RoseTTAFold All-Atom, which "models 32% of cases successfully (< 2A ligand RMSD) compared to 8% for the AutoDock Vina server"38

Generation tasks:

  • Protein sequences: ESM-2 masked language modeling
  • DNA sequences at scale: Evo (up to 650kb sequences)

Foundation Model Selection Guide. Choose your model based on task type, sequence length requirements, and data availability. Figure 7: Decision tree for selecting the appropriate genomic foundation model based on your task and constraints. Generated by author based on model characteristics discussed in this article.

The Metagenomic Atlas: What Scale Actually Buys You

The ESM Metagenomic Atlas demonstrates what becomes possible when speed and scale combine. "We fold over 617 million sequences from the MGnify90 database"39, producing "approximately 365 million predictions with good confidence"40 including "more than 225 million high confidence predictions"41.

Evo introduces a 131k context window genomic foundation model using the StripedHyena architecture, trained on 300 billion nucleotides from prokaryotic genomes. Figure 8: Evo architecture showing StripedHyena design and training data composition. Source: Nguyen et al., "Evo: Genomic Foundation Model", 202442

The scientific impact is what matters. These aren't just re-predictions of known structures. "76.8% of high confidence predictions being separate from UniRef90 by at least 90% sequence identity"43, and "12.6% without a match to experimentally determined structures"44. These are genuinely novel folds discovered by a language model.

Open Source Availability and Model Access

Every model discussed here has open weights. Here's where to find them:

ESM family: Available at github.com/facebookresearch/esm with weights on HuggingFace. The ESM Metagenomic Atlas contains "more than 617 million structures"1 with "more than 225 million high confidence predictions"41.

DNABERT-2: github.com/MAGICS-LAB/DNABERT_2 with HuggingFace integration.

Nucleotide Transformer: github.com/instadeepai/nucleotide-transformer with four model variants.

HyenaDNA: Via the Hazy Research group with pretrained checkpoints.

Evo: github.com/evo-design/evo with 7B parameter weights. Evo is "a 7 billion parameter genomic foundation model trained to generate DNA sequences at whole-genome scale"45 using "a context length of 131k tokens"46. The training data "OpenGenome dataset with over 80000 bacterial and archaeal genomes and millions of predicted prokaryotic phage and plasmid sequences covering 300B nucleotide tokens"47 is also released.

scGPT: Available on HuggingFace, pretrained on "over 33 million cells"18.

What These Models Can't Do (Yet)

The papers rarely emphasize limitations, but several are important:

Context limitations persist. Even HyenaDNA's 1M token context covers only ~0.03% of the human genome. The human genome contains 3.2 billion nucleotides48. Modeling chromosome-scale interactions remains out of reach.

Interpretability is limited. These models learn useful representations, but extracting mechanistic understanding remains challenging. You get predictions, not explanations. As the ProtTrans authors noted, their "models learned some of the grammar of the language of life"49, but what exactly that grammar encodes remains partially opaque.

Cell type-specific performance varies. Recent benchmarking shows "we do not see a clear advantage for larger models, with cellPLM exhibiting comparable performance to the smaller ScGPT-H and even smaller Geneformer"50. If your task involves rare cell types or unusual regulatory contexts, expect reduced accuracy.

Training data bias exists. Models trained primarily on well-studied organisms may struggle with non-model organisms. The Nucleotide Transformer's multispecies training helps, but coverage is uneven.

Evo achieves state-of-the-art zero-shot fitness prediction across proteins, ncRNA, and mRNA, outperforming specialized models without task-specific training. Figure 9: Evo zero-shot fitness prediction performance across multiple molecular types. Source: Nguyen et al., "Evo: Genomic Foundation Model", 202442

Getting Started: A 30-Minute Quickstart

If you want to run inference today, here's the fastest path:

  1. Install: pip install fair-esm transformers for protein models, or pip install transformers for DNA models

  2. Load pretrained weights (ESM-2 example):

"""
ESM-2 Model Loading Example
===========================

This script demonstrates how to load Facebook's ESM-2 protein language model
using the fair-esm library. ESM-2 is a state-of-the-art protein foundation model
trained on millions of protein sequences.

Dependencies:
    - torch
    - fair-esm (pip install fair-esm)

Reference:
    Lin et al. "Evolutionary-scale prediction of atomic-level protein structure
    with a language model" Science (2023)
"""

import torch
import esm


def load_esm2_model(model_name: str = "esm2_t33_650M_UR50D"):
    """
    Load an ESM-2 model and its batch converter.

    Args:
        model_name: Name of the ESM-2 model variant. Options include:
            - "esm2_t6_8M_UR50D"    (8M parameters, fastest)
            - "esm2_t12_35M_UR50D"  (35M parameters)
            - "esm2_t30_150M_UR50D" (150M parameters)
            - "esm2_t33_650M_UR50D" (650M parameters, recommended)
            - "esm2_t36_3B_UR50D"   (3B parameters, most accurate)

    Returns:
        tuple: (model, alphabet, batch_converter)
            - model: The ESM-2 PyTorch model
            - alphabet: Tokenizer for converting sequences to tokens
            - batch_converter: Utility for preparing batched inputs
    """
    # Load pre-trained ESM-2 model
    # This downloads weights on first run (~2.5GB for 650M model)
    model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()

    # Create batch converter for tokenizing sequences
    batch_converter = alphabet.get_batch_converter()

    # Set model to evaluation mode (disables dropout)
    model.eval()

    return model, alphabet, batch_converter


def prepare_protein_batch(sequences: list, batch_converter) -> tuple:
    """
    Prepare protein sequences for model input.

    Args:
        sequences: List of tuples (name, sequence_string)
            Example: [("protein1", "MKTVRQERLK"), ("protein2", "GALTISGTW")]
        batch_converter: The batch converter from ESM alphabet

    Returns:
        tuple: (batch_labels, batch_strs, batch_tokens)
            - batch_labels: List of sequence names
            - batch_strs: List of sequence strings
            - batch_tokens: Tokenized tensor ready for model input
    """
    batch_labels, batch_strs, batch_tokens = batch_converter(sequences)
    return batch_labels, batch_strs, batch_tokens


# Example usage
if __name__ == "__main__":
    # Load the model
    model, alphabet, batch_converter = load_esm2_model()
    print("Model loaded successfully!")
    print(f"  - Parameters: {sum(p.numel() for p in model.parameters()):,}")
    print(f"  - Embedding dimension: {model.embed_dim}")
    print(f"  - Number of layers: {model.num_layers}")
    print(f"  - Attention heads: {model.attention_heads}")
    print(f"  - Vocabulary size: {len(alphabet)}")

    # Example protein sequences
    example_sequences = [
        ("hemoglobin_alpha", "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK"),
        ("insulin_b_chain", "FVNQHLCGSHLVEALYLVCGERGFFYTPKT"),
    ]

    # Prepare batch and run inference
    print(f"\nPreparing {len(example_sequences)} protein sequences...")
    batch_labels, batch_strs, batch_tokens = prepare_protein_batch(
        example_sequences, batch_converter
    )
    print(f"  - Batch token shape: {tuple(batch_tokens.shape)}")
    print(f"  - Sequences: {batch_labels}")

    print("\nRunning forward pass...")
    with torch.no_grad():
        results = model(batch_tokens, repr_layers=[33], return_contacts=False)

    # Extract representations from final layer
    token_representations = results["representations"][33]
    print(f"  - Output shape: {tuple(token_representations.shape)}")
    print("    (batch_size x sequence_length x embedding_dim)")

Sample Output:

Model loaded successfully!
  - Parameters: 651,043,254
  - Embedding dimension: 1280
  - Number of layers: 33
  - Attention heads: 20
  - Vocabulary size: 33

Preparing 2 protein sequences...
  - Batch token shape: (2, 144)
  - Sequences: ['hemoglobin_alpha', 'insulin_b_chain']

Running forward pass...
  - Output shape: (2, 144, 1280)
    (batch_size x sequence_length x embedding_dim)
  1. Extract embeddings with mean pooling (the best pooling strategy per Feng et al.):
"""
ESM-2 Embedding Extraction with Mean Pooling
=============================================

Extract protein embeddings from ESM-2 and apply mean pooling
to obtain fixed-size sequence representations for downstream tasks.
"""

import torch
import esm
import numpy as np
from typing import List, Tuple


def extract_embeddings_with_pooling(
    sequences: List[Tuple[str, str]],
    model,
    batch_converter,
    layer: int = 33,
    pooling: str = "mean",
    device: str = "cpu"
) -> dict:
    """
    Extract protein embeddings from ESM-2 with sequence-level pooling.

    Args:
        sequences: List of (name, sequence) tuples
        model: ESM-2 model
        batch_converter: Alphabet batch converter
        layer: Which transformer layer to extract from (default: final layer)
        pooling: Pooling strategy - "mean", "max", or "cls"
        device: Device to run inference on ("cpu" or "cuda")

    Returns:
        dict: {
            "embeddings": numpy array of shape (num_sequences, embedding_dim),
            "labels": list of sequence names,
            "per_residue": list of per-residue embeddings
        }
    """
    model = model.to(device)
    model.eval()

    # Prepare batch
    batch_labels, batch_strs, batch_tokens = batch_converter(sequences)
    batch_tokens = batch_tokens.to(device)

    # Extract representations
    with torch.no_grad():
        results = model(batch_tokens, repr_layers=[layer], return_contacts=False)

    token_reps = results["representations"][layer]

    pooled_embeddings = []
    per_residue_embeddings = []

    for i, (tokens, seq_str) in enumerate(zip(token_reps, batch_strs)):
        seq_len = len(seq_str)
        # Extract residue tokens (exclude <cls> and <eos>)
        residue_reps = tokens[1:seq_len + 1]
        per_residue_embeddings.append(residue_reps.cpu().numpy())

        if pooling == "mean":
            pooled = residue_reps.mean(dim=0)
        elif pooling == "max":
            pooled = residue_reps.max(dim=0)[0]
        elif pooling == "cls":
            pooled = tokens[0]
        else:
            raise ValueError(f"Unknown pooling strategy: {pooling}")

        pooled_embeddings.append(pooled.cpu().numpy())

    return {
        "embeddings": np.stack(pooled_embeddings),
        "labels": batch_labels,
        "per_residue": per_residue_embeddings
    }


def compute_sequence_similarity(emb1: np.ndarray, emb2: np.ndarray) -> float:
    """Compute cosine similarity between two embeddings."""
    dot_product = np.dot(emb1, emb2)
    norm1 = np.linalg.norm(emb1)
    norm2 = np.linalg.norm(emb2)
    return dot_product / (norm1 * norm2)


# Example usage
if __name__ == "__main__":
    # Load model
    model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
    batch_converter = alphabet.get_batch_converter()

    # Example proteins (homologs should show high similarity)
    proteins = [
        ("human_hba", "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTK"),
        ("mouse_hba", "MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTK"),
        ("insulin_b", "FVNQHLCGSHLVEALYLVCGERGFFYTPKT"),
    ]

    # Extract embeddings
    result = extract_embeddings_with_pooling(
        proteins, model, batch_converter, layer=33, pooling="mean"
    )

    embeddings = result["embeddings"]
    labels = result["labels"]

    # Full pairwise cosine similarity matrix
    print("Cosine Similarity Matrix:")
    print(" " * 12 + "".join(f"{name:>12}" for name in labels))
    for i, name in enumerate(labels):
        row = "".join(
            f"{compute_sequence_similarity(embeddings[i], embeddings[j]):>12.3f}"
            for j in range(len(labels))
        )
        print(f"{name:>12}{row}")

Sample Output:

Cosine Similarity Matrix:
               human_hba   mouse_hba   insulin_b
   human_hba       1.000       0.997       0.953
   mouse_hba       0.997       1.000       0.954
   insulin_b       0.953       0.954       1.000

Human and mouse haemoglobin alpha, which are homologous, score 0.997. Insulin B, from an unrelated family, sits lower against both at 0.953 and 0.954. Note that ESM-2 cosine similarities are compressed into a narrow high range, so treat the ordering as meaningful and the absolute values as not directly comparable across model sizes.

  1. Use embeddings for downstream tasks: Feed into a simple classifier or regressor.

For DNA models, the HuggingFace integration makes loading equally straightforward. The key is starting with embeddings before attempting fine-tuning.

The Future: Multimodal Integration

The field is moving toward models that integrate multiple modalities. "RoseTTAFold All-Atom (RFAA) a deep network capable of modeling full biological assemblies containing proteins nucleic acids small molecules metals and covalent modifications"51 represents this trend.

Evo generates functional CRISPR-Cas systems de novo. Generated Cas9 proteins show 36-71% sequence identity to natural systems while maintaining predicted structural integrity. Figure 10: Evo CRISPR-Cas generation demonstrating de novo design of functional systems. Source: Nguyen et al., "Evo: Genomic Foundation Model", 202442

Similarly, Evo demonstrates that DNA foundation models can "generate coding-rich sequences up to 650 kb in length orders of magnitude longer than previous methods"52. This suggests future workflows will use fewer, more general models rather than task-specific architectures.

"Compared to HyenaDNA Evo is based on an improved hybrid design and scaled to 1000x larger model size and 100x more data"53. The architecture is "a hybrid of 29 layers of data-controlled convolutional operators interleaved with 3 layers (10%) of multi-head attention"54, combining the efficiency of convolutions with the expressiveness of attention where it matters most.

Conclusion

The genomic foundation model space offers genuine capability improvements, but the practical path forward requires matching model choice to your specific constraints. For most bioinformaticians, the recommendation is straightforward:

  • Start small: DNABERT-2 or ESM-2 650M will handle most tasks with minimal infrastructure
  • Use mean token pooling: It consistently outperforms alternatives
  • Fine-tune with a parameter-efficient method: Full fine-tuning is rarely necessary
  • Validate on held-out data: Benchmarks don't transfer perfectly to your specific use case

These models do not make experimental structural biology obsolete. They depend on it for training data, and high-resolution applications still need experimental validation. What has changed is the cost of a first pass: predicting structures across a whole metagenome is now a compute-scheduling problem rather than an impossible one.


References

Footnotes

  1. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "more than 617 million structures" 2

  2. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "We were able to complete the predictions in 2 weeks on a cluster of approximately 2,000 GPUs"

  3. Dalla-Torre, H., et al. "The Nucleotide Transformer: Building and Evaluating Robust Foundation Models for Human Genomics." Nature Methods, 2024. 2 3

  4. Zhou, Z., et al. "DNABERT-2: Efficient Foundation Model and Benchmark for Multi-Species Genome." ICLR, 2024. "achieves comparable performance to the state-of-the-art model with 21x fewer parameters and approximately 92x less GPU time in pre-training"

  5. Zhou, Z., et al. "DNABERT-2: Efficient Foundation Model and Benchmark for Multi-Species Genome." ICLR, 2024. "DNABERT-2 117M parameters"

  6. Zhou, Z., et al. "DNABERT-2: Efficient Foundation Model and Benchmark for Multi-Species Genome." ICLR, 2024. "BPE significantly reduces the sequence length by approximately 5 times"

  7. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "context lengths of up to 1 million tokens at the single nucleotide-level"

  8. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "an up to 500x increase over previous dense attention-based models"

  9. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "At sequence length 1M, HyenaDNA is 160x faster than its Transformer counterpart"

  10. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "A Hyena operator can be evaluated in O(L log L) time"

  11. Dalla-Torre, H., et al. "The Nucleotide Transformer: Building and Evaluating Robust Foundation Models for Human Genomics." Nature Methods, 2024. "integrating information from 3202 diverse human genomes as well as 850 genomes from a wide range of species"

  12. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "scale language models from 8 million parameters up to 15 billion parameters"

  13. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "the largest language model of proteins to date"

  14. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "prediction that is up to 60x faster than state-of-the-art while maintaining resolution and accuracy"

  15. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "On a single NVIDIA V100 GPU, ESMFold makes a prediction on a protein with 384 residues in 14.2 seconds, 6x faster than a single AlphaFold2 model"

  16. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "On shorter sequences the improvement increases up to approximately 60x"

  17. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022.

  18. Cui, H., et al. "scGPT: Toward Building a Foundation Model for Single-Cell Multi-Omics." Nature Methods, 2024. "33 million scRNA-seq data of human cells" 2

  19. Cui, H., et al. "scGPT: Toward Building a Foundation Model for Single-Cell Multi-Omics." Nature Methods, 2024. "51 organs/tissues and 441 studies"

  20. Theodoris, C., et al. "Transfer learning enables predictions in network biology." Nature, 2024. "larger pre-training data sizes yield superior pre-trained embeddings"

  21. Theodoris, C., et al. "Transfer learning enables predictions in network biology." Nature, 2024. "8 to 12% increase in the biological conservation score compared to the trained-from-scratch models"

  22. Zhou, Z., et al. "DNABERT-2: Efficient Foundation Model and Benchmark for Multi-Species Genome." ICLR, 2024. "About 14 days on 8 NVIDIA RTX 2080Ti V.S. 28 days on 128 NVIDIA A100" 2 3

  23. Liu, Z., et al. "GenBench: A Benchmarking Suite for Systematic Evaluation of Genomic Foundation Models." arXiv:2406.01627, 2024. "encompasses ten popular GFMs and performs extensive experiments across forty-three realistic datasets"

  24. Feng, H., Wu, L., Zhao, B., Huff, C., Zhang, J., Wu, J., Lin, L., Wei, P., & Wu, C. "Benchmarking DNA foundation models for genomic and genetic tasks." Nature Communications, 16, 10780 (2025). https://doi.org/10.1038/s41467-025-65823-8 "Our analysis reveals that mean token embedding consistently and significantly improves sequence classification performance, outperforming other pooling strategies"

  25. Liu, Z., et al. "GenBench: A Benchmarking Suite for Systematic Evaluation of Genomic Foundation Models." arXiv:2406.01627, 2024. "four attention-based models and six convolution-based models"

  26. Liu, Z., et al. "GenBench: A Benchmarking Suite for Systematic Evaluation of Genomic Foundation Models." arXiv:2406.01627, 2024. "HyenaDNA and Caduceus utilize the hyena operator and state space model with complexity of O(L log L) and O(L) significantly lower than O(L^2) of attention-based models" 2

  27. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. 2

  28. Liu, Z., et al. "GenBench: A Benchmarking Suite for Systematic Evaluation of Genomic Foundation Models." arXiv:2406.01627, 2024. "the Coding Region comprising only about 1.5% of the genome is responsible for coding proteins"

  29. Liu, Z., et al. "GenBench: A Benchmarking Suite for Systematic Evaluation of Genomic Foundation Models." arXiv:2406.01627, 2024. "the vast Non-coding Region making up 98.5% of the genome plays crucial roles in gene regulation"

  30. Elnaggar, A., et al. "ProtTrans: Toward Understanding the Language of Life Through Self-Supervised Learning." IEEE TPAMI, 2021. "training on the Summit supercomputer using 5616 GPUs and TPU Pod up to 1024 cores"

  31. Dalla-Torre, H., et al. "The Nucleotide Transformer: Building and Evaluating Robust Foundation Models for Human Genomics." Nature Methods, 2024. "parameter-efficient fine-tuning technique requiring only 0.1% of the total model parameters" 2

  32. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "HyenaDNA effectively solves the task by using a context length of 450k to 1 million"

  33. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "99.5% accuracy"

  34. Dalla-Torre, H., et al. "The Nucleotide Transformer: Building and Evaluating Robust Foundation Models for Human Genomics." Nature Methods, 2024. "the sequence representations alone match or outperform specialized methods on 12 of 18 prediction tasks"

  35. Dalla-Torre, H., et al. "The Nucleotide Transformer: Building and Evaluating Robust Foundation Models for Human Genomics." Nature Methods, 2024. "fine-tuned models matched or surpassed 15 of the 18 baselines with the largest and more diverse models constantly outperforming their smaller counterparts"

  36. Cui, H., et al. "scGPT: Toward Building a Foundation Model for Single-Cell Multi-Omics." Nature Methods, 2024.

  37. Cui, H., et al. "scGPT: Toward Building a Foundation Model for Single-Cell Multi-Omics." Nature Methods, 2024. "scGPT achieves an AvgBIO score of 0.821, which is 5-10% higher than the compared methods"

  38. Krishna, R., et al. "RoseTTAFold All-Atom." Science, 2024. "RFAA models 32% of cases successfully (< 2A ligand RMSD) compared to 8% for the AutoDock Vina server"

  39. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "We fold over 617 million sequences from the MGnify90 database"

  40. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "approximately 365 million predictions with good confidence"

  41. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "more than 225 million high confidence predictions" 2

  42. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. 2 3

  43. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "76.8% of high confidence predictions being separate from UniRef90 by at least 90% sequence identity"

  44. Lin, Z., et al. "ESM-2: Evolutionary Scale Modeling of Protein Sequences." Science, 2022. "12.6% without a match to experimentally determined structures"

  45. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "a 7 billion parameter genomic foundation model trained to generate DNA sequences at whole-genome scale"

  46. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "a context length of 131k tokens"

  47. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "OpenGenome dataset with over 80000 bacterial and archaeal genomes and millions of predicted prokaryotic phage and plasmid sequences covering 300B nucleotide tokens"

  48. Nguyen, E., et al. "HyenaDNA: Long-Range Genomic Sequence Modeling at Single Nucleotide Resolution." NeurIPS, 2023. "the human genome is 3.2B nucleotides"

  49. Elnaggar, A., et al. "ProtTrans: Toward Understanding the Language of Life Through Self-Supervised Learning." IEEE TPAMI, 2021. "ProtTrans models learned some of the grammar of the language of life"

  50. Gene Properties Language Models Study. arXiv, 2024. "we do not see a clear advantage for larger models, with cellPLM exhibiting comparable performance to the smaller ScGPT-H and even smaller Geneformer"

  51. Krishna, R., et al. "RoseTTAFold All-Atom." Science, 2024. "RoseTTAFold All-Atom (RFAA) a deep network capable of modeling full biological assemblies containing proteins nucleic acids small molecules metals and covalent modifications"

  52. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "Evo can generate coding-rich sequences up to 650 kb in length orders of magnitude longer than previous methods"

  53. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "Compared to HyenaDNA Evo is based on an improved hybrid design and scaled to 1000x larger model size and 100x more data"

  54. Nguyen, E., et al. "Evo: A 7-Billion Parameter Genomic Foundation Model." Science, 2024. "a hybrid of 29 layers of data-controlled convolutional operators interleaved with 3 layers (10%) of multi-head attention"

Frequently asked

Which genomic foundation model should I use for DNA sequence analysis?
For DNA sequence tasks under 4kb, use DNABERT-2 (117M parameters, runs on consumer GPUs). For sequences 6kb-100kb, use HyenaDNA at 32k context. For sequences over 100kb, use HyenaDNA at 1M context or Evo. DNABERT-2 achieves comparable performance with 21x fewer parameters and 92x less GPU time than alternatives.
What's the best protein language model for structure prediction?
ESM-2 650M is the recommended default for most tasks, fitting on a single 8GB GPU while capturing most benchmark improvements. ESMFold delivers structure prediction up to 60x faster than AlphaFold2 while maintaining accuracy. For protein-ligand complexes, use RoseTTAFold All-Atom which models 32% of cases successfully compared to 8% for AutoDock Vina.
How do I choose between attention-based and convolution-based genomic models?
For sequences under 4kb, attention-based models like DNABERT-2 work well. Beyond that, quadratic O(L^2) scaling becomes prohibitive. HyenaDNA uses O(L log L) Hyena operators, making it 160x faster than transformers at 1M sequence length. Mamba-based models offer O(L) linear scaling for the longest sequences.
What hardware do I need to run genomic foundation models?
ESM-2 650M needs 8GB VRAM, DNABERT-2 needs 4GB VRAM, and HyenaDNA needs 4GB base but scales with context length. The 15B ESM-2 requires 80GB+ VRAM (multi-GPU). Most practical work uses parameter-efficient fine-tuning; the Nucleotide Transformer authors report needing only 0.1% of parameters using (IA)3, making single-GPU training viable for most tasks.
Should I fine-tune or use zero-shot embeddings from foundation models?
Zero-shot works well for standard regulatory element classification, cross-species tasks, and when you have fewer than 1000 labeled examples. The Nucleotide Transformer shows sequence representations alone match or outperform specialized methods on 12 of 18 tasks. Fine-tune when you need maximum accuracy on specific tasks or custom sequence types.
What pooling strategy should I use for sequence classification with genomic foundation models?
Use mean token pooling. Feng et al.'s benchmark of DNA foundation models (Nature Communications, 2025) found that mean token embedding consistently and significantly improves sequence classification performance, outperforming CLS token pooling and max pooling strategies across multiple genomic tasks.

Help improve this article

Found an error or a better source? Leave a note here, or highlight a passage to comment on it.